There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Mobala mammarenavirus (MOBV) (isolate Rat/Central African Republic/Acar 3080/1983) Pre-glycoprotein polyprotein GP complex (260-491 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Mobala mammarenavirus (MOBV) (isolate Rat/Central African Republic/Acar 3080/1983) |
| Fragment | 260-491 aa |
| Sequence | GTFTWTLSDSEGNDLPGGYCLQRWMLIEAEMKCFGNTAVAKCNQQHDEEFCDMLRLFDFN KEAIHRLRVEAEKSISLINKAVNSLINDQLIMRNHLRDIMGIPYCNYSRFWYLNDTRSGR TSLPKCWMVSNGSYLNETHFSSDIEQEANNMITEMLRKEYERRQGTTPLGLVDLFVFSTS FYLISVFLHLIKIPTHRHLVGKPCPKPHRLNHMGVCSCGLYKQPGLPTKWKR |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | GPC |
| Full Name | Pre-glycoprotein polyprotein GP complex |
| Gene ID | 5075845 |
| Uniprot ID | Q2A069 |
| Background | Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor. |
| Alternate Names | GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2 |