0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Orosomucoid 2 (ORM2) protein [His-Tag], E. coli (CAT#: GP01-105J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Orosomucoid 2 (ORM2) protein (NP_035146.1) (Gln19-Ala207) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Gln19-Ala207
Sequence MGHHHHHHSGSEFQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA
Tag His-Tag at the N-terminus
Predicted MW 23.4 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ORM2
Full Name Orosomucoid 2
Gene ID 18406
Uniprot ID P07361
Accession Number NP_035146.1
Background Orosomucoid 2 (ORM2) is an important glycoprotein that is mainly biosynthesized and secreted by hepatocytes.
Alternate Names Orm; Agp1; Orm-2; ORM2; Orosomucoid 2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on