Recombinant Mouse Orosomucoid 2 (ORM2) protein [His-Tag], E. coli (CAT#: GP01-105J)

Product Overview	Recombinant Mouse Orosomucoid 2 (ORM2) protein (NP_035146.1) (Gln19-Ala207) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Gln19-Ala207
Sequence	MGHHHHHHSGSEFQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA
Tag	His-Tag at the N-terminus
Predicted MW	23.4 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ORM2
Full Name	Orosomucoid 2
Gene ID	18406
Uniprot ID	P07361
Accession Number	NP_035146.1
Background	Orosomucoid 2 (ORM2) is an important glycoprotein that is mainly biosynthesized and secreted by hepatocytes.
Alternate Names	Orm; Agp1; Orm-2; ORM2; Orosomucoid 2