0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Platelet glycoprotein v (GP5) [His-tag and T7-tag], E. coli (CAT#: GP01-107J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Platelet glycoprotein v (GP5) (Ser246-Glu485) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Ser246-Glu485
Sequence MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFSLTLSGNLLESLPPALFLHVSSVSRLTLFENPLEELPDVLFGEMAGLRELWLNGTHLSTLPAAAFRNLSGLQTLGLTRNPRLSALPRGVFQGLRELRVLGLHTNALAELRDDALRGLGHLRQVSLRHNRLRALPRTLFRNLSSLESVQLEHNQLETLPGDVFAALPQLTQVLLGHNPWLCDCGLWRFLQWLRHHPDILGRDEPPQCRGPEPRASLSFWELLQGDPWCPDPRSLPLDPPTE
Tag His-tag and T7-tag at the N-terminus
Predicted MW 30.8 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target GP5
Full Name Platelet glycoprotein v
Uniprot ID O08742
Background The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis.
Alternate Names GPV; Glycoprotein 5; GP5; Platelet glycoprotein v
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on