Recombinant Mouse Platelet glycoprotein v (GP5) [His-tag and T7-tag], E. coli (CAT#: GP01-107J)

Product Overview	Recombinant Mouse Platelet glycoprotein v (GP5) (Ser246-Glu485) was expressed in E. coli with a His-tag and T7-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Ser246-Glu485
Sequence	MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFSLTLSGNLLESLPPALFLHVSSVSRLTLFENPLEELPDVLFGEMAGLRELWLNGTHLSTLPAAAFRNLSGLQTLGLTRNPRLSALPRGVFQGLRELRVLGLHTNALAELRDDALRGLGHLRQVSLRHNRLRALPRTLFRNLSSLESVQLEHNQLETLPGDVFAALPQLTQVLLGHNPWLCDCGLWRFLQWLRHHPDILGRDEPPQCRGPEPRASLSFWELLQGDPWCPDPRSLPLDPPTE
Tag	His-tag and T7-tag at the N-terminus
Predicted MW	30.8 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	GP5
Full Name	Platelet glycoprotein v
Uniprot ID	O08742
Background	The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis.
Alternate Names	GPV; Glycoprotein 5; GP5; Platelet glycoprotein v