0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein E (US8) (21-568 aa), E. coli (CAT#: GPX04-346J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997) Envelope glycoprotein E (NP_944450.1) (21-568 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Psittacid herpesvirus 1 (PsHV-1) (isolate Amazon parrot/-/97-0001/1997)
Fragment 21-568 aa
Sequence QRVDSTTIHHVSGLKGKPLLFGPSLRRTLPAGGTFKWVLVLSDPCAPKPTEICVSVGHCF YDLVSSDNDSECANKDRRVLTLALLTKSKTGELRVIGPMAASSALVGDAGELEQLRRRVS AGMGLTDDGDISFAAADKVNEGLYGVRVMGSGDSYTFFNVTVATETAGDDRDLATVRHVD IAHNIVPSEDRDHVFVSMPRMHVAWPHGTTVLHPKMIIAAASWRPEYNFTYEWYAVPYDG YCATMRLFEACLYHPSAPACLDPAGHRGCVVGTMTHDDLVGRVLMARCRGSDLRTCEPHV IHIKQKPMVSLGRAVPELRVESAAHIPSLYILVVKIDDSVAGWAYTELMAEGSSPRVVID IHMPRPTSAQGGIAALREIENDDSAPSLGSNEGGGPGNSKRRAAVLGAAVWIALTLLILG GLGAYVAVNKKCLRDKRQWLRGSRKPTLETHAHTYTSLPVGGDLSLEQDAEDEDEDEEEL LYERERRRSSSGSKKSSRSPSRRSSRRNSFGPTLSANALSRFDKTVKLAMAEVAGRLLAN KTFPSQRY
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target US8
Full Name Envelope glycoprotein E
Gene ID 2656958
Uniprot ID Q6UDF4
Accession Number NP_944450.1
Background In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips.
Alternate Names Envelope glycoprotein E
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.