0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rabies virus (strain India) Glycoprotein (G) (20-459 aa) [His-SUMO], E. coli (CAT#: GP02-038J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Rabies virus (strain India) Glycoprotein (20-459 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Rabies virus (strain India)
Fragment 20-459 aa
Sequence KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 65.4 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target G
Full Name Glycoprotein
Uniprot ID A3RM22
Background This protein attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane.
Alternate Names Glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on