0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Microfibril associated protein 4 (MFAP4) [His-Tag], E. coli (CAT#: GP01-087J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Microfibril associated protein 4 (MFAP4) (NP_001185624.1) (Gln243-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Gln243-Lys369
Sequence MGHHHHHHSGSEFQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Tag His-Tag at the N-terminus
Predicted MW 16.1 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target MFAP4
Full Name Microfibril associated protein 4
Gene ID 4239
Uniprot ID P47853
Accession Number NP_001185624.1
Background This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene.
Alternate Names MFAP4; Microfibril associated protein 4
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on