Recombinant Rat Microfibril associated protein 4 (MFAP4) [His-Tag], E. coli

Recombinant Rat Microfibril associated protein 4 (MFAP4) (NP_001185624.1) (Gln243-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.

Determined by its binding ability in a functional ELISA.

Rat

Gln243-Lys369

MGHHHHHHSGSEFQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

His-Tag at the N-terminus

16.1 KDa

>95%, determined by SDS-PAGE and HPLC

<1 EU/μg, determined by the LAL method

Unconjugated

MFAP4

Microfibril associated protein 4

This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene.

MFAP4; Microfibril associated protein 4