Recombinant Rat Microfibril associated protein 4 (MFAP4) [His-Tag], E. coli (CAT#: GP01-087J)

Product Overview	Recombinant Rat Microfibril associated protein 4 (MFAP4) (NP_001185624.1) (Gln243-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Gln243-Lys369
Sequence	MGHHHHHHSGSEFQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Tag	His-Tag at the N-terminus
Predicted MW	16.1 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	MFAP4
Full Name	Microfibril associated protein 4
Gene ID	4239
Uniprot ID	P47853
Accession Number	NP_001185624.1
Background	This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene.
Alternate Names	MFAP4; Microfibril associated protein 4