There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 10 μg | ||
| 50 μg | ||
| 200 μg |
| Product Overview | Recombinant Rat Microfibril associated protein 4 (MFAP4) (NP_001185624.1) (Gln243-Lys369) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Rat |
| Fragment | Gln243-Lys369 |
| Sequence | MGHHHHHHSGSEFQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Tag | His-Tag at the N-terminus |
| Predicted MW | 16.1 KDa |
| Purity | >95%, determined by SDS-PAGE and HPLC |
| Endotoxin Level | <1 EU/μg, determined by the LAL method |
| Conjugation | Unconjugated |
| Target | MFAP4 |
| Full Name | Microfibril associated protein 4 |
| Gene ID | 4239 |
| Uniprot ID | P47853 |
| Accession Number | NP_001185624.1 |
| Background | This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. |
| Alternate Names | MFAP4; Microfibril associated protein 4 |