0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Peripheral myelin protein 22 (Pmp22) (1-160 aa) [His-tag], E. coli (CAT#: GP02-080J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Rat Peripheral myelin protein 22 (NP_058733.1) (1-160 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Rat
Fragment 1-160 aa
Sequence MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE
Tag 10xHis-tag at the N-terminus
Predicted MW 23.4 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Pmp22
Full Name Peripheral myelin protein 22
Gene ID 24660
Uniprot ID P25094
Accession Number NP_058733.1
Background This protein mediates Schwann cell growth and peripheral myelin compaction; human homolog gene duplication causes Charcot-Marie-Tooth 1A (CMT1A) neuropathy.
Alternate Names Gas-3
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving