Recombinant Rat Sortilin 1 (Sort1) (610-754 aa) [His-SUMO], E. coli (CAT#: GP02-146J)

Product Overview	Recombinant Rat Sortilin 1 (NP_113955.1) (610-754 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Rat
Fragment	610-754 aa
Sequence	CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	32.5 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Sort1
Full Name	Sortilin 1
Gene ID	83576
Uniprot ID	O54861
Accession Number	NP_113955.1
Background	This protein functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Lysosomal proteins bind specifically to the receptor in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex.
Alternate Names	Nt3; Nts3