0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rotavirus A (isolate SI/South Africa/H96/58) Non-structural glycoprotein 4 (52-175 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-397J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Rotavirus A (isolate SI/South Africa/H96/58 ) Non-structural glycoprotein 4 (52-175 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rotavirus A (isolate SI/South Africa/H96/58)
Fragment 52-175 aa
Sequence PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 30.6 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target Non-structural glycoprotein 4
Full Name Non-structural glycoprotein 4
Gene ID 7011361
Uniprot ID A2T3Q0
Background Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca2+ in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly.
Alternate Names NSP4; NCVP5; NS28
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving