There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Rotavirus A (RV-A) Outer capsid glycoprotein VP7 (51-326 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11]) |
| Fragment | 51-326 aa |
| Sequence | QNYGINLPITGSMDTSYVNATKDEPFLTSTLCLYYPTEARTEINDNEWTSTLSQLFLTKGWPTGSVYFKEYDDIATFSVDPQLYCDYNIVLMRYNSSLKLDMSELANLILNEWLSNPMDITLYYYQQTDEANKWIA mgQSCTIKVCPLNTQTLGIGCQTTNTGTFEEVATAEKLVITDVVDGVNHKLDVTTATCTIRNCKKLGPRENVAVIQVGGADILDITSDPTTNPQTERMMRINWKKWWQVFYTIVDYVNQIVQAMSKRSRSLNSAAFYYRV |
| Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
| Predicted MW | 36.4 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | Outer capsid glycoprotein VP7 |
| Full Name | Outer capsid glycoprotein VP7 |
| Uniprot ID | P17700 |
| Background | VP7 is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7. |
| Alternate Names | Outer capsid glycoprotein; VP7 |