0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rotavirus A (RV-A) Outer capsid glycoprotein VP7 (P25175) (51-326 aa) [His-tag], E. coli, Biotin labelled (CAT#: GP03-291J)

Datasheet
SizeQtyAdd To Basket
100 μg
500 μg
1 mg

Product Overview Recombinant Rotavirus A (RV-A) Outer capsid glycoprotein VP7 (51-326 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rotavirus A (strain RVA/Cow/United States/B641/XXXX/G6P7[5])
Fragment 51-326 aa
Sequence QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEMADTEWKDTLSQLFLTKGWPTGSVYFKEYTDIAAFSVEPQLYCDYNLVLMKYDSTQKLDMSELADLILNEWLCNPMDITLYYYQQTDEANKWIS mgSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVNHKLNVTTATCTIRNCKKLGPRENVAVIQVGGANILDITADPTTTPQTERMMRINWKKWWQVFYTVVDYVNQIIQTMSKRSRSLNSSAFYYRV
Tag His-tag at the N-terminus
Predicted MW 33.4 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Biotin
Target Outer capsid glycoprotein VP7
Full Name Outer capsid glycoprotein VP7
Uniprot ID P25175
Background VP7 is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Alternate Names Outer capsid glycoprotein; VP7
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving