Recombinant Rotavirus A (RV-A) Outer capsid glycoprotein VP7 (P04510) (51-326 aa) [His-tag], Yeast (CAT#: GP03-359J)

Product Overview	Recombinant Rotavirus A (RV-A) Outer capsid glycoprotein VP7 (51-326 aa) was expressed in Yeast with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Rotavirus A (strain RVA/Human/Japan/S2/1980/G2P1B[4])
Fragment	51-326 aa
Sequence	QNYGMYLPITGSLDAVYTNSTSGESFLTSTLCLYYPAEAKNEISDDEWENTLSQLFLTKGWPTGSVYFKDYNDITTFSMNPQLYCDYNVVLMRYDNTSELDVSELADLILNEWLCNPMDISLYYYQQNSESNKWIS mgTDCTVKVCPLNTQTLGIGCKITDVDTFEIVASSEKLVITDVVNGVNHKINISISTCTIRNCNKLGPRENVAIIQVGGPNALDITADPTTVPQVQRIMRVNWKKWWQVFYTVVDYINQIIQVMSKRSRSLDTAAFYYRI
Tag	His-tag at the N-terminus
Predicted MW	33.4 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Outer capsid glycoprotein VP7
Full Name	Outer capsid glycoprotein VP7
Uniprot ID	P04510
Background	VP7 is a calcium-binding protein that interacts with rotavirus cell receptors once the initial attachment by VP4 has been achieved. Rotavirus attachment and entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. Following entry into the host cell, low intracellular or intravesicular Ca2+ concentration probably causes the calcium-stabilized VP7 trimers to dissociate from the virion. This step is probably necessary for the membrane-disrupting entry step and the release of VP4, which is locked onto the virion by VP7.
Alternate Names	Outer capsid glycoprotein; VP7