0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Varicella-zoster virus (strain Dumas) Envelope glycoprotein L (gL) (22-159 aa) [His/Myc-Tag], E. coli (CAT#: GP02-050J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Varicella-zoster virus (strain Dumas) Envelope glycoprotein L (22-159 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Varicella-zoster virus (strain Dumas)
Fragment 22-159 aa
Sequence LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLAQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 22.6 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gL
Full Name Envelope glycoprotein L
Uniprot ID P09308
Background The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.
Alternate Names gL; ORF60
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on