There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg | ||
1 mg |
Product Overview | Recombinant Varicella-zoster virus (strain Oka vaccine) Envelope glycoprotein L (23-160 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | E. coli |
Species | Varicella-zoster virus (strain Oka vaccine) |
Fragment | 23-160 aa |
Sequence | LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLTQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ |
Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
Predicted MW | 22.6 kDa |
Purity | >95%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | gL |
Full Name | Envelope glycoprotein L |
Uniprot ID | Q9J3N1 |
Background | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH. |
Alternate Names | gL; ORF60 |