0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Bovine coronavirus (strain Quebec) Spike glycoprotein (S) (314-634 aa) [His-Tag], Yeast (CAT#: GP02-095J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Bovine coronavirus (strain Quebec) Spike glycoprotein (314-634 aa) was expressed in Yeast with a 6xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Bovine coronavirus (strain Quebec)
Fragment 314-634 aa
Sequence TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQFVFKPQPVGVFTHHDVVYAQHCFKAPKNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFIFHDVNSGTTCSTDLQKSNTDIILGVCVNY
Tag 6xHis-tag at the C-terminus
Predicted MW 36.8 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target S
Full Name Spike glycoprotein
Uniprot ID P25193
Background Spike protein S1 attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Spike protein S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Alternate Names S glycoprotein; E7; Peplomer protein; S
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving