0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4) Envelope glycoprotein N (gN) (33-102 aa), E. coli (CAT#: GPX04-081J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4) Envelope glycoprotein N (33-102 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Fragment 33-102 aa
Sequence SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gN
Full Name Envelope glycoprotein N
Gene ID 3783716
Uniprot ID P0C6Z3
Background Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names gN; BLRF1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving