Recombinant Bovine herpesvirus 1.1 (BoHV-1) Envelope glycoprotein N (gN) (22-96 aa), E. coli (CAT#: GPX04-029J)

Product Overview	Recombinant Bovine herpesvirus 1.1 (BoHV-1) Envelope glycoprotein N (NP_045309.1) (22-96 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Bovine herpesvirus 1.1 (BoHV-1)
Fragment	22-96 aa
Sequence	RDPLLDAMRREGAMDFWSAGCYARGVPLSEPPQALVVFYVALTAVMVAVALYAYGLCFRL MGASGPNKKESRGRG
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gN
Full Name	Envelope glycoprotein N
Gene ID	4783426
Uniprot ID	Q77CE4
Accession Number	NP_045309.1
Background	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names	Envelope glycoprotein N