There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Equine arteritis virus (EAV) (strain Bucyrus) Glycoprotein 4 (NP_065658.1) (22-152 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Equine arteritis virus (EAV) (strain Bucyrus) |
| Fragment | 22-152 aa |
| Sequence | TFYPCHAAEARNFTYISHGLGHVHGHEGCRNFINVTHSAFLYLNPTTPTAPAITHCLLLV LAAKMEHPNATIWLQLQPFGYHVAGDVIVNLEEDKRHPYFKLLRAPALPLGFVAIVYVLL RLVRWAQRCYL |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | GP4 |
| Full Name | Glycoprotein 4 |
| Gene ID | 921343 |
| Uniprot ID | P28994 |
| Accession Number | NP_065658.1 |
| Background | Minor envelope protein. Part of the glycoproteins heterotrimer GP2b-GP3-GP4 which is probably responsible for the attachment to target host cell. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. |
| Alternate Names | Glycoprotein 4 |