0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Equine arteritis virus (EAV) (strain Bucyrus) Glycoprotein 4 (GP4) (22-152 aa), E. coli (CAT#: GPX04-083J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Equine arteritis virus (EAV) (strain Bucyrus) Glycoprotein 4 (NP_065658.1) (22-152 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Equine arteritis virus (EAV) (strain Bucyrus)
Fragment 22-152 aa
Sequence TFYPCHAAEARNFTYISHGLGHVHGHEGCRNFINVTHSAFLYLNPTTPTAPAITHCLLLV LAAKMEHPNATIWLQLQPFGYHVAGDVIVNLEEDKRHPYFKLLRAPALPLGFVAIVYVLL RLVRWAQRCYL
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GP4
Full Name Glycoprotein 4
Gene ID 921343
Uniprot ID P28994
Accession Number NP_065658.1
Background Minor envelope protein. Part of the glycoproteins heterotrimer GP2b-GP3-GP4 which is probably responsible for the attachment to target host cell. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis.
Alternate Names Glycoprotein 4
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on