0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Porcine reproductive and respiratory syndrome virus (PRRSV) (strain Lelystad) Glycoprotein 4 (GP4) (23-183 aa), E. coli (CAT#: GPX04-338J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Porcine reproductive and respiratory syndrome virus (PRRSV) (strain Lelystad) Glycoprotein 4 (23-183 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Porcine reproductive and respiratory syndrome virus (PRRSV) (strain Lelystad)
Fragment 23-183 aa
Sequence CKPCFSTHLSDIETNTTAAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGTPQY ITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHV TQHTQQHHLVIDHIRLLHFLTPSAMRWATTIACLFAILLAI
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GP4
Full Name Glycoprotein 4
Uniprot ID Q04568
Background Minor envelope protein. Along with GP2a, serves as the viral attachment protein responsible for mediating interactions with CD163 thereby playing a role in virus entry into susceptible host cells
Alternate Names Glycoprotein 4
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.