0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Equine herpesvirus 2 (EHV-2) (strain 86/87) Envelope glycoprotein N (gN) (25-89 aa), E. coli (CAT#: GPX04-101J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Equine herpesvirus 2 (EHV-2) (strain 86/87) Envelope glycoprotein N (NP_042650.1) (25-89 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Equine herpesvirus 2 (EHV-2) (strain 86/87)
Fragment 25-89 aa
Sequence SQNSTTPSKFPTFYSYDCNADTYAPQLTSFSTIWTLLNVLVMTIACVIYLIYMCFNKFVA TMTNT
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gN
Full Name Envelope glycoprotein N
Gene ID 1461050
Uniprot ID Q66655
Accession Number NP_042650.1
Background Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names Envelope glycoprotein N
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on