Recombinant Equine herpesvirus 2 (EHV-2) (strain 86/87) Envelope glycoprotein N (gN) (25-89 aa), E. coli (CAT#: GPX04-101J)

Product Overview	Recombinant Equine herpesvirus 2 (EHV-2) (strain 86/87) Envelope glycoprotein N (NP_042650.1) (25-89 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Equine herpesvirus 2 (EHV-2) (strain 86/87)
Fragment	25-89 aa
Sequence	SQNSTTPSKFPTFYSYDCNADTYAPQLTSFSTIWTLLNVLVMTIACVIYLIYMCFNKFVA TMTNT
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gN
Full Name	Envelope glycoprotein N
Gene ID	1461050
Uniprot ID	Q66655
Accession Number	NP_042650.1
Background	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names	Envelope glycoprotein N