Recombinant Equine herpesvirus 1 (EHV-1) (strain V592) Envelope glycoprotein N (gN) (28-100 aa), E. coli (CAT#: GPX04-099J)

Product Overview	Recombinant Equine herpesvirus 1 (EHV-1) (strain V592) Envelope glycoprotein N (28-100 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Equine herpesvirus 1 (EHV-1) (strain V592)
Fragment	28-100 aa
Sequence	DPGVKQRIDVAREEERRDFWHAACSGHGFPITTPSTAAILFYVSLLAVGVAVACQAYRAV LRIVTLEMLQHLH
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gN
Full Name	Envelope glycoprotein N
Gene ID	1487565
Uniprot ID	P84449
Background	Envelope glycoprotein necessary for proper maturation of gM and modulation of its membrane fusion activity. Plays also a critical role in virion morphogenesis.
Alternate Names	Envelope glycoprotein N