There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990) Pre-glycoprotein polyprotein GP complex (NP_899210.1) (246-479 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990) |
| Fragment | 246-479 aa |
| Sequence | AFFSWSLSDPKGNDMPGGYCLERWMLVAGDLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN KNAIEKLNNQTKTAVNMLTHSINSLISDNLLMRNKLKEILKVPYCNYTRFWYINHTKSGE HSLPRCWLVSNGSYLNESDFRNEWILESDHLIAEMLSKEYQDRQGKTPLTLVDLCFWSAI FFTTSLFLHLVGFPTHRHIQGDPCPLPHRLDRNGACRCGRFQKLGKQVTWKRKH |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | GPC |
| Full Name | Pre-glycoprotein polyprotein GP complex |
| Gene ID | 2943169 |
| Uniprot ID | Q8AYW1 |
| Accession Number | NP_899210.1 |
| Background | Glycoprotein G1 interacts with the host receptor and mediates virus attachment to host TFRC. Glycoprotein G is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. |
| Alternate Names | Pre-glycoprotein polyprotein GP complex |