0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Guanarito mammarenavirus (GTOV) Pre-glycoprotein polyprotein GP complex (GPC) (246-479 aa), E. coli (CAT#: GPX04-114J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990) Pre-glycoprotein polyprotein GP complex (NP_899210.1) (246-479 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990)
Fragment 246-479 aa
Sequence AFFSWSLSDPKGNDMPGGYCLERWMLVAGDLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN KNAIEKLNNQTKTAVNMLTHSINSLISDNLLMRNKLKEILKVPYCNYTRFWYINHTKSGE HSLPRCWLVSNGSYLNESDFRNEWILESDHLIAEMLSKEYQDRQGKTPLTLVDLCFWSAI FFTTSLFLHLVGFPTHRHIQGDPCPLPHRLDRNGACRCGRFQKLGKQVTWKRKH
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPC
Full Name Pre-glycoprotein polyprotein GP complex
Gene ID 2943169
Uniprot ID Q8AYW1
Accession Number NP_899210.1
Background Glycoprotein G1 interacts with the host receptor and mediates virus attachment to host TFRC. Glycoprotein G is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm.
Alternate Names Pre-glycoprotein polyprotein GP complex
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on