Recombinant Guanarito mammarenavirus (GTOV) Pre-glycoprotein polyprotein GP complex (GPC) (246-479 aa), E. coli (CAT#: GPX04-114J)

Product Overview	Recombinant Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990) Pre-glycoprotein polyprotein GP complex (NP_899210.1) (246-479 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Guanarito mammarenavirus (GTOV) (isolate Human/Venezuela/NH-95551/1990)
Fragment	246-479 aa
Sequence	AFFSWSLSDPKGNDMPGGYCLERWMLVAGDLKCFGNTAVAKCNLNHDSEFCDMLRLFDFN KNAIEKLNNQTKTAVNMLTHSINSLISDNLLMRNKLKEILKVPYCNYTRFWYINHTKSGE HSLPRCWLVSNGSYLNESDFRNEWILESDHLIAEMLSKEYQDRQGKTPLTLVDLCFWSAI FFTTSLFLHLVGFPTHRHIQGDPCPLPHRLDRNGACRCGRFQKLGKQVTWKRKH
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GPC
Full Name	Pre-glycoprotein polyprotein GP complex
Gene ID	2943169
Uniprot ID	Q8AYW1
Accession Number	NP_899210.1
Background	Glycoprotein G1 interacts with the host receptor and mediates virus attachment to host TFRC. Glycoprotein G is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm.
Alternate Names	Pre-glycoprotein polyprotein GP complex