Recombinant Machupo virus (MACV) Pre-glycoprotein polyprotein GP complex (GPC) (263-496 aa), E. coli (CAT#: GPX04-278J)

Product Overview	Recombinant Machupo virus (MACV) Pre-glycoprotein polyprotein GP complex (263-496 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Machupo virus (MACV)
Fragment	263-496 aa
Sequence	AFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTAVAKCNQNHDSEFCDMLRLFDYN KNAIKTLNDESKKEINLLSQTVNALISDNLLMKNKIKELMSIPYCNYTKFWYVNHTLTGQ HTLPRCWLIRNGSYLNTSEFRNDWILESDHLISEMLSKEYAERQGKTPITLVDICFWSTV FFTASLFLHLVGIPTHRHLKGEACPLPHKLDSFGGCRCGKYPRLRKPTIWHKRH
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	GPC
Full Name	Pre-glycoprotein polyprotein GP complex
Uniprot ID	Q6IUF7
Background	Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names	GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2