0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) (Ala180-Ser298) [His-Tag], E. coli (CAT#: GP01-024J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) (NP_001176.1) (Ala180-Ser298) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Ala180-Ser298
Sequence MGHHHHHHSGSAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
Tag His-Tag at the N-terminus
Predicted MW 14.6 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target AZGP1
Full Name Alpha-2-glycoprotein 1, zinc-binding
Gene ID 563
Uniprot ID P25311
Accession Number NP_001176.1
Background Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis.
Alternate Names ZAG; ZA2G; AZGP1; Alpha-2-glycoprotein 1, zinc-binding
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on