There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) (NP_001176.1) (Ala180-Ser298) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Human |
Fragment | Ala180-Ser298 |
Sequence | MGHHHHHHSGSAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS |
Tag | His-Tag at the N-terminus |
Predicted MW | 14.6 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | AZGP1 |
Full Name | Alpha-2-glycoprotein 1, zinc-binding |
Gene ID | 563 |
Uniprot ID | P25311 |
Accession Number | NP_001176.1 |
Background | Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis. |
Alternate Names | ZAG; ZA2G; AZGP1; Alpha-2-glycoprotein 1, zinc-binding |