Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) (Ala180-Ser298) [His-Tag], E. coli (CAT#: GP01-024J)

Product Overview	Recombinant Human Alpha-2-glycoprotein 1, zinc-binding (AZGP1) (NP_001176.1) (Ala180-Ser298) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Ala180-Ser298
Sequence	MGHHHHHHSGSAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
Tag	His-Tag at the N-terminus
Predicted MW	14.6 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	AZGP1
Full Name	Alpha-2-glycoprotein 1, zinc-binding
Gene ID	563
Uniprot ID	P25311
Accession Number	NP_001176.1
Background	Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis.
Alternate Names	ZAG; ZA2G; AZGP1; Alpha-2-glycoprotein 1, zinc-binding