Recombinant Mouse Alpha-2-glycoprotein 1, zinc (AZGP1) [His-Tag], E. coli (CAT#: GP01-018J)

Product Overview	Recombinant Mouse Alpha-2-glycoprotein 1, zinc (AZGP1) (NP_038506.2) (Glu178-Gln307) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Glu178-Gln307
Sequence	MGHHHHHHSGSEFEEECPEMLKRYLNYSRSHLDRIDPPTVTITSRVIPGGNRIFKCLAYGFYPQRISLHWNKANKKLAFEPERGVFPNGNGTYLSWAEVEVSPQDIDPFFCLIDHRGFSQSLSVQWDRTRKVKDENNVVAQPQ
Tag	His-Tag at the N-terminus
Predicted MW	16.6 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	AZGP1
Full Name	Alpha-2-glycoprotein 1, zinc
Gene ID	12007
Uniprot ID	Q64726
Accession Number	NP_038506.2
Background	Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis.
Alternate Names	ZA; ZAG; AZGP1; Alpha-2-glycoprotein 1, zinc