There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Mouse Alpha-2-glycoprotein 1, zinc (AZGP1) (NP_038506.2) (Glu178-Gln307) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Mouse |
Fragment | Glu178-Gln307 |
Sequence | MGHHHHHHSGSEFEEECPEMLKRYLNYSRSHLDRIDPPTVTITSRVIPGGNRIFKCLAYGFYPQRISLHWNKANKKLAFEPERGVFPNGNGTYLSWAEVEVSPQDIDPFFCLIDHRGFSQSLSVQWDRTRKVKDENNVVAQPQ |
Tag | His-Tag at the N-terminus |
Predicted MW | 16.6 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | AZGP1 |
Full Name | Alpha-2-glycoprotein 1, zinc |
Gene ID | 12007 |
Uniprot ID | Q64726 |
Accession Number | NP_038506.2 |
Background | Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis. |
Alternate Names | ZA; ZAG; AZGP1; Alpha-2-glycoprotein 1, zinc |