0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Alpha-2-glycoprotein 1, zinc (AZGP1) [His-Tag], E. coli (CAT#: GP01-018J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Alpha-2-glycoprotein 1, zinc (AZGP1) (NP_038506.2) (Glu178-Gln307) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Glu178-Gln307
Sequence MGHHHHHHSGSEFEEECPEMLKRYLNYSRSHLDRIDPPTVTITSRVIPGGNRIFKCLAYGFYPQRISLHWNKANKKLAFEPERGVFPNGNGTYLSWAEVEVSPQDIDPFFCLIDHRGFSQSLSVQWDRTRKVKDENNVVAQPQ
Tag His-Tag at the N-terminus
Predicted MW 16.6 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target AZGP1
Full Name Alpha-2-glycoprotein 1, zinc
Gene ID 12007
Uniprot ID Q64726
Accession Number NP_038506.2
Background Zinc-alpha-2-glycoprotein is a protein that in humans is encoded by the AZGP1 gene. This gene expresses a soluble protein that stimulates lipolysis.
Alternate Names ZA; ZAG; AZGP1; Alpha-2-glycoprotein 1, zinc
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on