Recombinant Human CD59 molecule (CD59) (26-102 aa) [His-Tag], Yeast (CAT#: GP02-013J)

Product Overview	Recombinant Human CD59 molecule (NP_000602.1) (26-102 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	Yeast
Species	Human
Fragment	26-102 aa
Sequence	LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Tag	6xHis-tag at the N-terminus
Predicted MW	11.0 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD59
Full Name	CD59 molecule
Gene ID	966
Uniprot ID	P13987
Accession Number	NP_000602.1
Background	This protein is a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation.
Alternate Names	1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20