0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human CD59 molecule (CD59) (26-102 aa) [His-Tag], Yeast (CAT#: GP02-013J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human CD59 molecule (NP_000602.1) (26-102 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Human
Fragment 26-102 aa
Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Tag 6xHis-tag at the N-terminus
Predicted MW 11.0 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD59
Full Name CD59 molecule
Gene ID 966
Uniprot ID P13987
Accession Number NP_000602.1
Background This protein is a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation.
Alternate Names 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on