Recombinant Human CD63 molecule (CD63) (103-203 aa) [His-Tag], E. coli (CAT#: GP02-014J)

Product Overview	Recombinant Human CD63 molecule (NP_001771.1) (103-203 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	103-203 aa
Sequence	AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Tag	6xHis-tag at the N-terminus
Predicted MW	15.5 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CD63
Full Name	CD63 molecule
Gene ID	967
Uniprot ID	P08962
Accession Number	NP_001771.1
Background	The protein is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Alternate Names	MLA1; ME491; LAMP-3; OMA81H; TSPAN30