There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
100 μg |
Product Overview | Recombinant Human CD63 molecule (NP_001771.1) (103-203 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Source | Yeast |
Species | Human |
Fragment | 103-203 aa |
Sequence | AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV |
Tag | 6xHis-tag at the N-terminus |
Predicted MW | 13.5 kDa |
Purity | >90%, determined by SDS-PAGE. |
Conjugation | Unconjugated |
Target | CD63 |
Full Name | CD63 molecule |
Gene ID | 967 |
Uniprot ID | P08962 |
Accession Number | NP_001771.1 |
Background | The protein is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. |
Alternate Names | MLA1; ME491; LAMP-3; OMA81H; TSPAN30 |