0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human CD63 molecule (CD63) (103-203 aa) [His-Tag], Yeast (CAT#: GP02-015J)

Datasheet
SizeQtyAdd To Basket
100 μg

Product Overview Recombinant Human CD63 molecule (NP_001771.1) (103-203 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source Yeast
Species Human
Fragment 103-203 aa
Sequence AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Tag 6xHis-tag at the N-terminus
Predicted MW 13.5 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CD63
Full Name CD63 molecule
Gene ID 967
Uniprot ID P08962
Accession Number NP_001771.1
Background The protein is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Alternate Names MLA1; ME491; LAMP-3; OMA81H; TSPAN30
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on