There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Human Clusterin (NP_001822.3) (23-224 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | E. coli |
| Species | Human |
| Fragment | 23-224 aa |
| Sequence | DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 27.8 kDa |
| Purity | >95%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | CLU |
| Full Name | Clusterin |
| Gene ID | 1191 |
| Uniprot ID | P10909 |
| Accession Number | NP_001822.3 |
| Background | The protein is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants. |
| Alternate Names | CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2 |