Recombinant Human Clusterin (CLU) (23-224 aa) [His-Tag], E. coli (CAT#: GP02-024J)

Product Overview	Recombinant Human Clusterin (NP_001822.3) (23-224 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	23-224 aa
Sequence	DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
Tag	6xHis-tag at the N-terminus
Predicted MW	27.8 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	CLU
Full Name	Clusterin
Gene ID	1191
Uniprot ID	P10909
Accession Number	NP_001822.3
Background	The protein is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Alternate Names	CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2