0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Clusterin (CLU) (23-224 aa) [His-Tag], E. coli (CAT#: GP02-024J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human Clusterin (NP_001822.3) (23-224 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human
Fragment 23-224 aa
Sequence DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
Tag 6xHis-tag at the N-terminus
Predicted MW 27.8 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target CLU
Full Name Clusterin
Gene ID 1191
Uniprot ID P10909
Accession Number NP_001822.3
Background The protein is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Alternate Names CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on