Recombinant Human Complement c1q binding protein (C1QBP) [His-Tag], E. coli (CAT#: GP01-034J)

Product Overview	Recombinant Human Complement c1q binding protein (C1QBP) (NP_001203.1) (Thr76-Gln282) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Thr76-Gln282
Sequence	MGHHHHHHSGSTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Tag	His-Tag at the N-terminus
Predicted MW	24.8 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	C1QBP
Full Name	Complement c1q binding protein
Gene ID	708
Uniprot ID	Q07021
Accession Number	NP_001203.1
Background	The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Alternate Names	p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32; C1QBP; Complement c1q binding protein