0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Complement c1q binding protein (C1QBP) [His-Tag], E. coli (CAT#: GP01-034J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Complement c1q binding protein (C1QBP) (NP_001203.1) (Thr76-Gln282) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Thr76-Gln282
Sequence MGHHHHHHSGSTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Tag His-Tag at the N-terminus
Predicted MW 24.8 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target C1QBP
Full Name Complement c1q binding protein
Gene ID 708
Uniprot ID Q07021
Accession Number NP_001203.1
Background The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.
Alternate Names p32; HABP1; gC1qR; GC1QBP; SF2p32; gC1Q-R; COXPD33; SF2AP32; C1QBP; Complement c1q binding protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on