0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Complement component 1, q subcomponent binding protein (C1QBP) [His-Tag], E. coli (CAT#: GP01-037J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Complement component 1, q subcomponent binding protein (C1QBP) (Leu72-Gln279) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Leu72-Gln279
Sequence MGHHHHHHSGSLHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQTTGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Tag His-Tag at the N-terminus
Predicted MW 25 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target C1QBP
Full Name Complement component 1, q subcomponent binding protein
Uniprot ID O35796
Background This protein is believed to be a multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, protein synthesis in mitochondria, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing.
Alternate Names P3; HAB; P32; HABP1; gC1qBP; AA407365; AA986492; D11Wsu182; D11Wsu182e; C1QBP; Complement component 1, q subcomponent binding protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on