There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Rat Complement component 1, q subcomponent binding protein (C1QBP) (Leu72-Gln279) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Rat |
Fragment | Leu72-Gln279 |
Sequence | MGHHHHHHSGSLHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPELTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQTTGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ |
Tag | His-Tag at the N-terminus |
Predicted MW | 25 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | C1QBP |
Full Name | Complement component 1, q subcomponent binding protein |
Uniprot ID | O35796 |
Background | This protein is believed to be a multifunctional and multicompartmental protein involved in inflammation and infection processes, ribosome biogenesis, protein synthesis in mitochondria, regulation of apoptosis, transcriptional regulation and pre-mRNA splicing. |
Alternate Names | P3; HAB; P32; HABP1; gC1qBP; AA407365; AA986492; D11Wsu182; D11Wsu182e; C1QBP; Complement component 1, q subcomponent binding protein |