Book a Meeting

0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human cytomegalovirus (strain AD169) Envelope glycoprotein B (gB) (552-635 aa) [His/Myc-Tag], E. coli (CAT#: GP02-043J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human cytomegalovirus (strain AD169) Envelope glycoprotein B (552-635 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human cytomegalovirus (strain AD169)
Fragment 552-635 aa
Sequence TINQTSVKVLRDMNVKESPGRCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSAYEYVDYLFKRM
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 17.1 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gB
Full Name Envelope glycoprotein B
Uniprot ID P06473
Background This protein is an envelope glycoprotein that plays a role in host cell entry, cell to-cell virus transmission, and fusion of infected cells. May be involved in the initial attachment via binding to heparan sulfate together with the gM/gN complex that binds heparin with higher affinity. Interacts with host integrin ITGB1, PDGFRA and EGFR that likely serve as postattachment entry receptors. Participates also in the fusion of viral and cellular membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL.
Alternate Names Glycoprotein B
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on