0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D (gD) (26-340 aa) [His/Myc-Tag], E. coli (CAT#: GP02-046J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D (26-340 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human herpesvirus 1 (strain KOS)
Fragment 26-340 aa
Sequence KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNM
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 42.3 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gD
Full Name Envelope glycoprotein D
Uniprot ID A1Z0Q5
Background This protein is an envelope glycoprotein that binds to the potential host cell entry receptors TNFRSF14/HVEM, NECTIN1 and 3-O-sulfated heparan sulfate. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL .
Alternate Names Glycoprotein D
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on