Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D (gD) (26-340 aa) [His/Myc-Tag], E. coli (CAT#: GP02-046J)

Product Overview	Recombinant Human herpesvirus 1 (strain KOS) Envelope glycoprotein D (26-340 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human herpesvirus 1 (strain KOS)
Fragment	26-340 aa
Sequence	KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNM
Tag	10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW	42.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gD
Full Name	Envelope glycoprotein D
Uniprot ID	A1Z0Q5
Background	This protein is an envelope glycoprotein that binds to the potential host cell entry receptors TNFRSF14/HVEM, NECTIN1 and 3-O-sulfated heparan sulfate. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL .
Alternate Names	Glycoprotein D