Recombinant Suid herpesvirus 1 (SuHV-1) Envelope glycoprotein D (gD) (18-402 aa) [His-tag], E. coli (CAT#: GP03-391J)

Product Overview	Recombinant Suid herpesvirus 1 (SuHV-1) Envelope glycoprotein D (18-402 aa) was expressed in E. coli with a His-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Suid herpesvirus 1 (SuHV-1)
Fragment	18-402 aa
Sequence	ADVDAVPAPTFPPPAYPYTESWQLTLTTVPSPFVGPADVYHTRPLEDPCGVVALISDPQVDRLLNEAVAHRRPTYRAHVAWYRIADGCAHLLYFIEYADCDPRQVFGRCRRRTTPMWWTPSADYMFPTEDELGLLMVAPGRFNEGQYRRLVSVDGVNILTDFMVALPEGQECPFARVDQHRTYKFGACWSDDSFKRGVDVMRFLTPFYQQPPHREVVNYWYRKNGRTLPRAHAAATPYAIDPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPATRDHAAGGRPTPRPPRPETPHRPFAPPAVVPSGWPQPAEPFQPRTPAAPGVSRHRSVIVGTGTA mgALLVGVCVYIFFRLRGAKGYRLLGGPADADELKAQPGP
Tag	His-tag at the N-terminus
Predicted MW	44.8 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gD
Full Name	Envelope glycoprotein D
Uniprot ID	P07645
Background	Envelope glycoprotein that binds to host cell entry receptors. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL.
Alternate Names	Protein gp50