There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Human herpesvirus 5 (HHV-5) (strain Merlin) Membrane glycoprotein UL144 (21-176 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Human herpesvirus 5 (HHV-5) (strain Merlin) |
| Fragment | 21-176 aa |
| Sequence | KVCQHNEVQLGNECCPPCGLGQRVTKVCTERTSVTCTPCPNGTYVSGLYNCTDCTQCNVT QVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | UL144 |
| Full Name | Membrane glycoprotein UL144 |
| Gene ID | 3077471 |
| Uniprot ID | F5HAM0 |
| Background | Activates NF-kappa-B in a tumor necrosis factor receptor (TNFR)-associated factor 6 (TRAF6)-dependent manner, causing the up-regulation of the chemokine CCL22. |
| Alternate Names | TNF alpha-like receptor UL144; UL144 protein |