Recombinant Human herpesvirus 5 (HHV-5) (strain Toledo) Membrane glycoprotein UL144 (UL144) (21-176 aa), E. coli (CAT#: GPX04-209J)

Product Overview	Recombinant Human herpesvirus 5 (HHV-5) (strain Toledo) Membrane glycoprotein UL144 (21-176 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human herpesvirus 5 (HHV-5) (strain Toledo)
Fragment	21-176 aa
Sequence	KVCQHNEVQLGNECCPPCGSGQRVTKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVT QVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	UL144
Full Name	Membrane glycoprotein UL144
Uniprot ID	Q68396
Background	Activates NF-kappaB in a tumor necrosis factor receptor (TNFR)-associated factor 6 (TRAF6)-dependent manner, causing the up-regulation of the chemokine CCL22.
Alternate Names	TNF alpha-like receptor UL144; UL144 protein