0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 5 (HHV-5) (strain Toledo) Membrane glycoprotein UL144 (UL144) (21-176 aa), E. coli (CAT#: GPX04-209J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human herpesvirus 5 (HHV-5) (strain Toledo) Membrane glycoprotein UL144 (21-176 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human herpesvirus 5 (HHV-5) (strain Toledo)
Fragment 21-176 aa
Sequence KVCQHNEVQLGNECCPPCGSGQRVTKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVT QVMIRNCTSTNNTVCAPKNHTYFSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLF IFLVGIILLILYLIAAYRSERCQQCCSIGKIFYRTL
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target UL144
Full Name Membrane glycoprotein UL144
Uniprot ID Q68396
Background Activates NF-kappaB in a tumor necrosis factor receptor (TNFR)-associated factor 6 (TRAF6)-dependent manner, causing the up-regulation of the chemokine CCL22.
Alternate Names TNF alpha-like receptor UL144; UL144 protein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on