0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (gB) (23-188 aa) [His/Myc-Tag], E. coli (CAT#: GP02-040J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Human herpesvirus 6A (strain Uganda-1102) Glycoprotein B (23-188 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Human herpesvirus 6A (strain Uganda-1102)
Fragment 23-188 aa
Sequence DPDHYIRAGYNHKYPFRICSIAKGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDVGVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNLFPLNFKSITNKRFITTKEPYFARGPLWL
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 26.8 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target gB
Full Name Glycoprotein B
Gene ID 1487917
Uniprot ID P28864
Background This envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moieties of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.
Alternate Names gB
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on