Recombinant Human Intercellular adhesion molecule 1 (ICAM1) (28-480 aa) [GST-Tag], E. coli (CAT#: GP02-063J)

Product Overview	Recombinant Human Intercellular adhesion molecule 1 (NP_000192.2) (28-480 aa) was expressed in E. coli with a GST-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	28-480 aa
Sequence	QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Tag	GST-tag at the N-terminus
Predicted MW	76.5 kDa
Purity	>95%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	ICAM1
Full Name	Intercellular adhesion molecule 1
Gene ID	3383
Uniprot ID	P05362
Accession Number	NP_000192.2
Background	This protein is a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.
Alternate Names	BB2; CD54; P3.58