Recombinant Human Intercellular adhesion molecule 1 (ICAM1) (28-532) [His-Tag or Tag-free], E. coli (CAT#: GP02-064J)

Product Overview	Recombinant Human Intercellular adhesion molecule 1 (NP_000192.2) (28-532) was expressed in E. coli with a His-tag at the N-terminus or Tag-free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source	E. coli
Species	Human
Fragment	28-532
Sequence	QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Tag	His-tag at the N-terminus or Tag-free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	ICAM1
Full Name	Intercellular adhesion molecule 1
Gene ID	3383
Uniprot ID	P05362
Accession Number	NP_000192.2
Background	This protein is a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.
Alternate Names	BB2; CD54; P3.58