0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human Orosomucoid 1 (ORM1) protein [His-Tag], E. coli (CAT#: GP01-096J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Human Orosomucoid 1 (ORM1) protein (NP_000598.2) (Gln19-Ser201) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human
Fragment Gln19-Ser201
Sequence MGHHHHHHSGSEFQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Tag His-Tag at the N-terminus
Predicted MW 23.1 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ORM1
Full Name Orosomucoid 1
Gene ID 5004
Uniprot ID P02763
Accession Number NP_000598.2
Background This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression.
Alternate Names ORM; AGP1; AGP-A; HEL-S-153w; ORM1; Orosomucoid 1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving