Recombinant Human Orosomucoid 1 (ORM1) protein [His-Tag], E. coli (CAT#: GP01-096J)

Product Overview	Recombinant Human Orosomucoid 1 (ORM1) protein (NP_000598.2) (Gln19-Ser201) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human
Fragment	Gln19-Ser201
Sequence	MGHHHHHHSGSEFQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Tag	His-Tag at the N-terminus
Predicted MW	23.1 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ORM1
Full Name	Orosomucoid 1
Gene ID	5004
Uniprot ID	P02763
Accession Number	NP_000598.2
Background	This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression.
Alternate Names	ORM; AGP1; AGP-A; HEL-S-153w; ORM1; Orosomucoid 1