0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Orosomucoid 1 (ORM1) protein [His-Tag], E. coli (CAT#: GP01-097J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Orosomucoid 1 (ORM1) protein (NP_032794.1) (Gln19-Ala207) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Gln19-Ala207
Sequence MGHHHHHHSGSEFQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
Tag His-Tag at the N-terminus
Predicted MW 23.5 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ORM1
Full Name Orosomucoid 1
Gene ID 18405
Uniprot ID Q60590
Accession Number NP_032794.1
Background This gene encodes a member of the lipocalin family of proteins. The encoded protein is an abundant acute-phase protein that is synthesized by hepatocytes in response to cytokines during the acute phase response. The encoded protein may regulate inflammation and metabolism. This gene is present in a gene cluster on chromosome 4.
Alternate Names Agp; Orm; Agp-1; Agp-2; Orm-1; ORM1; Orosomucoid 1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving