Recombinant Mouse Orosomucoid 1 (ORM1) protein [His-Tag], E. coli (CAT#: GP01-097J)

Product Overview	Recombinant Mouse Orosomucoid 1 (ORM1) protein (NP_032794.1) (Gln19-Ala207) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Mouse
Fragment	Gln19-Ala207
Sequence	MGHHHHHHSGSEFQNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
Tag	His-Tag at the N-terminus
Predicted MW	23.5 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ORM1
Full Name	Orosomucoid 1
Gene ID	18405
Uniprot ID	Q60590
Accession Number	NP_032794.1
Background	This gene encodes a member of the lipocalin family of proteins. The encoded protein is an abundant acute-phase protein that is synthesized by hepatocytes in response to cytokines during the acute phase response. The encoded protein may regulate inflammation and metabolism. This gene is present in a gene cluster on chromosome 4.
Alternate Names	Agp; Orm; Agp-1; Agp-2; Orm-1; ORM1; Orosomucoid 1