Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (G) (67-298 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-229J)

Datasheet

Product Overview	Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (67-298 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Human respiratory syncytial virus A (strain A2)
Fragment	67-298 aa
Sequence	HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ
Tag	6xHis-SUMO-tag at the N-terminus
Predicted MW	41.3 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	G
Full Name	Major surface glycoprotein G
Uniprot ID	P03423
Background	Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
Alternate Names	Major surface glycoprotein G

Recombinant Rabies virus (RABV) (strain ERA) (RABV) Glycoprotein (G) (20-459 aa) [6xHis-tag], E. coli (CAT#: GPX04-362J)
Recombinant Hendra virus (isolate Horse/Autralia/Hendra/1994) Glycoprotein G (G) (1-604 aa), E. coli (CAT#: GPX04-122J)
Recombinant Rabies virus (strain PM1503/AVO1) (RABV) Glycoprotein (20-524 aa), E. coli (CAT#: GP05-369J)
Recombinant Rabies virus (RABV) (strain silver-haired bat-associated) Glycoprotein (G) (20-524 aa), E. coli (CAT#: GPX04-370J)
Recombinant Bovine respiratory syncytial virus (BRSV) (strain 4642) Major surface glycoprotein G (G) (1-263 aa), E. coli (CAT#: GPX04-038J)
Recombinant Khujand virus (KHUV) Glycoprotein (G) (20-526 aa), E. coli (CAT#: GPX04-266J)
Recombinant Rabies virus (strain ERA) (RABV) Glycoprotein (G), Yeast (CAT#: GPX-025-Y-J)
Recombinant Rabies virus (RABV) (strain CVS-11) Glycoprotein G (G) (20-459 aa) [10xHis-SUMO-tag and Myc-tag], E. coli (CAT#: GPX04-360J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications