Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (G) (67-298 aa) [6xHis-SUMO-tag], E. coli

Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (67-298 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.

Determined by its binding ability in a functional ELISA.

Human respiratory syncytial virus A (strain A2)

67-298 aa

HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

6xHis-SUMO-tag at the N-terminus

41.3 kDa

>90%, determined by SDS-PAGE.

Unconjugated

G

Major surface glycoprotein G

Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.

Major surface glycoprotein G