0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (G) (67-298 aa) [6xHis-SUMO-tag], E. coli (CAT#: GPX04-229J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human respiratory syncytial virus A (strain A2) Major surface glycoprotein G (67-298 aa) was expressed in E. coli with a 6xHis-SUMO-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human respiratory syncytial virus A (strain A2)
Fragment 67-298 aa
Sequence HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ
Tag 6xHis-SUMO-tag at the N-terminus
Predicted MW 41.3 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target G
Full Name Major surface glycoprotein G
Uniprot ID P03423
Background Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
Alternate Names Major surface glycoprotein G
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
  • ()
    ()
    ()
ISO 9001 Certified - Creative Biolabs Quality Management System.
Close
Thanksgiving
Thanksgiving