There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Infectious hematopoietic necrosis virus (IHNV) (strain Round Butte) Glycoprotein (21-508 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Infectious hematopoietic necrosis virus (IHNV) (strain Round Butte) |
| Fragment | 21-508 aa |
| Sequence | QTVKPDTASESDQPTWSNPLFTYPEGCTLDKLSKVNASQLRCPRIFDDENRGLIAYPTSI RSLSVGNDLGEIHTQGNHIHKVLYRTICSTGFFGGQTIEKALVEMKLSTKEAGAYDTTTA AALYFPAPRCQWYTDNVQNDLIFYYTTQKSVLRDPYTRDFLDSDFIGGKCTKSPCQTHWS NVVWMGDAGIPACDSSQEIKAHLFVDKISNRVVKATSYGHHPWGLHRACMIEFCGKQWIR TDLGDLISVEYNSGAEILSFPKCEDKTMGMRGNLDDFAYLDDLVKASESREECLEAHAEI ISTNSVTPYLLSKFRSPHPGINDVYAMHKGSIYHGMCMTVAVDEVSKDRTTYRAHRATSF TKWERPFGDEWEGFHGLHGNNTTIIPDLEKYVAQYKTSMMEPMSIKSVPHPSILAFYNET DLSGISIRKLDSFDLQSLHWSFWPTISALGGIPLVLLLAVAACCCWSGRPPTPSAPQSIP MYHLANRS |
| Tag | His-tag or Tag free |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | G |
| Full Name | Glycoprotein |
| Uniprot ID | P07923 |
| Background | Binds to specific receptor at cellular surface, bringing about the attachment of the virus particle to the cell. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the viral nucleocapsid into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in G, releasing a fusion hydrophobic peptide. |
| Alternate Names | Spike glycoprotein; G |