0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Human respiratory syncytial virus A (strain rsb6256) Major surface glycoprotein G (G) (1-297 aa), E. coli (CAT#: GPX04-238J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Human respiratory syncytial virus A (strain rsb6256) Major surface glycoprotein G (1-297 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Human respiratory syncytial virus A (strain rsb6256)
Fragment 1-297 aa
Sequence MSKTKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAII FIASANHKVTLTTAIIQDATSQIKNTTPTYLTQNPQLGISFSNLSETTSQPTTTPAPTTP SAESTPQSTTVKTKNTTTTQIQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNP TCWAICKRIPNKKPGKKTTTKPTKKPTIKTTKKDLKPQTTKPKEVLTTKPTEKPTINTTR TNIRTTLLTTNTTGNPEYTSQKETLHSTSPEGNPSPSQVYTTSEYPSQPPSPSNTTN
Tag His-tag or Tag free
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target G
Full Name Major surface glycoprotein G
Uniprot ID P27025
Background Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
Alternate Names Major surface glycoprotein G
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on