0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Lymphocytic choriomeningitis virus (LCMV) (strain WE) Pre-glycoprotein polyprotein GP complex (GPC) (59-265 aa) [6xHis-tag and Myc-tag], E. coli (CAT#: GPX04-276J)

Datasheet
SizeQtyAdd To Basket
1 mg
500 μg
100 μg

Product Overview Recombinant Lymphocytic choriomeningitis virus (LCMV) (strain WE) Pre-glycoprotein polyprotein GP complex (59-265 aa) was expressed in E. coli with a 6xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Lymphocytic choriomeningitis virus (LCMV) (strain WE)
Fragment 59-265 aa
Sequence MYGLNGPDIYKGVYQFKSVEFDMSHLNLTMPNACSVNNSHHYISMGSSGLEPTFTNDSILNHNFCNLTSALNKKSFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLSSSDPQSAMSQCRTFRGRVLDMFRTAFGGKYMRSGWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCRYAGPFGMSRILFAQEKTKFLTRRLS
Tag 6xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 30.9 kDa
Purity >90%, determined by SDS-PAGE.
Conjugation Unconjugated
Target GPC
Full Name Pre-glycoprotein polyprotein GP complex
Uniprot ID P07399
Background Glycoprotein G2 is a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced upon acidification in the endosome. Glycoprotein G1 interacts with the host receptor.
Alternate Names GPC; Pre-GP-C; Stable signal peptide; Glycoprotein G1; Glycoprotein G2
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving