Recombinant Rat Alpha-1-b glycoprotein (A1BG) (Met313-Ser513) [His-tag and S-tag], E. coli (CAT#: GP01-016J)

Product Overview	Recombinant Rat Alpha-1-b glycoprotein (A1BG) (NP_071594.2) (Met313-Ser513) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Met313-Ser513
Sequence	MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMWSDEKLPAPVLTAEPSSHNLEPGSTVQLRCTAHKAGLRFGLQRQGKPDLVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSASSEPLELRINGPAPKPRLEALWKGKVPLGHEAIFQCHGHVPRVSMELVREGFKTPFWMASTTSTSAFLKLSFVGPQHTGNYSCRYTALSPFTFESGISDPVEVVVEGS
Tag	His-tag and S-tag at the N-terminus
Predicted MW	27.3 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	A1BG
Full Name	Alpha-1-b glycoprotein
Gene ID	140656
Uniprot ID	Q9EPH1
Accession Number	NP_071594.2
Background	This protein may have a role in the immediate-early response phase of liver regeneration.
Alternate Names	C44; A1BG; Alpha-1-b glycoprotein