0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Alpha-1-b glycoprotein (A1BG) (Met313-Ser513) [His-tag and S-tag], E. coli (CAT#: GP01-016J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Alpha-1-b glycoprotein (A1BG) (NP_071594.2) (Met313-Ser513) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Met313-Ser513
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMWSDEKLPAPVLTAEPSSHNLEPGSTVQLRCTAHKAGLRFGLQRQGKPDLVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSASSEPLELRINGPAPKPRLEALWKGKVPLGHEAIFQCHGHVPRVSMELVREGFKTPFWMASTTSTSAFLKLSFVGPQHTGNYSCRYTALSPFTFESGISDPVEVVVEGS
Tag His-tag and S-tag at the N-terminus
Predicted MW 27.3 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target A1BG
Full Name Alpha-1-b glycoprotein
Gene ID 140656
Uniprot ID Q9EPH1
Accession Number NP_071594.2
Background This protein may have a role in the immediate-early response phase of liver regeneration.
Alternate Names C44; A1BG; Alpha-1-b glycoprotein
For Research Use Only.
Online Inquiry
  • (USA)
    (UK)
    (Germany)
  • Contact Us
  • Global Locations
Follow us on