There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 10 μg | ||
| 50 μg | ||
| 200 μg |
| Product Overview | Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (NP_001074536.1) (Gln220-Asn415) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | E. coli |
| Species | Mouse |
| Fragment | Gln220-Asn415 |
| Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSQAPPTLCLMGNYLMIYPQKTYETLACKAPRNAAEFQLRQGGKVLKIHGFSPTRDAILYYVNLKELDNPGPFTCRYRMHKYMHVWSEDSKPVELMWSDETLQAPVLTAEPSSRDLEPGSTVQLRCTAPVSGLRFGLQRQGKPELVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSSSSEPVELRVN |
| Tag | His-tag and S-tag at the N-terminus |
| Predicted MW | 27.4 KDa |
| Purity | >95%, determined by SDS-PAGE and HPLC |
| Endotoxin Level | <1 EU/μg, determined by the LAL method |
| Conjugation | Unconjugated |
| Target | A1BG |
| Full Name | Alpha-1-b glycoprotein |
| Gene ID | 117586 |
| Uniprot ID | Q19LI2 |
| Accession Number | NP_001074536.1 |
| Background | Restricted expression toward liver adult (RPKM 526.2). |
| Alternate Names | C44; A1BG; Alpha-1-b glycoprotein |