0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (Gln220-Asn415) [His-tag and S-tag], E. coli (CAT#: GP01-013J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Mouse Alpha-1-b glycoprotein (A1BG) (NP_001074536.1) (Gln220-Asn415) was expressed in E. coli with a His-tag and S-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Mouse
Fragment Gln220-Asn415
Sequence MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSQAPPTLCLMGNYLMIYPQKTYETLACKAPRNAAEFQLRQGGKVLKIHGFSPTRDAILYYVNLKELDNPGPFTCRYRMHKYMHVWSEDSKPVELMWSDETLQAPVLTAEPSSRDLEPGSTVQLRCTAPVSGLRFGLQRQGKPELVVVQMLNSSGTEAVFELHNISTIDSGNYSCIYMEQAPPFSGSSSSEPVELRVN
Tag His-tag and S-tag at the N-terminus
Predicted MW 27.4 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target A1BG
Full Name Alpha-1-b glycoprotein
Gene ID 117586
Uniprot ID Q19LI2
Accession Number NP_001074536.1
Background Restricted expression toward liver adult (RPKM 526.2).
Alternate Names C44; A1BG; Alpha-1-b glycoprotein
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving