There is no product in the shopping cart, buy it!
Size | Qty | Add To Basket |
---|---|---|
10 μg | ||
50 μg | ||
200 μg |
Product Overview | Recombinant Rat Orosomucoid 1 (ORM1) (NP_445740.1) (Gln19-Pro205) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
Biological Activity | Determined by its binding ability in a functional ELISA. |
Source | E. coli |
Species | Rat |
Fragment | Gln19-Pro205 |
Sequence | MGHHHHHHSGSEFQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
Tag | His-Tag at the N-terminus |
Predicted MW | 23.1 KDa |
Purity | >95%, determined by SDS-PAGE and HPLC |
Endotoxin Level | <1 EU/μg, determined by the LAL method |
Conjugation | Unconjugated |
Target | ORM1 |
Full Name | Orosomucoid 1 |
Gene ID | 24614 |
Uniprot ID | P02764 |
Accession Number | NP_445740.1 |
Background | This protein is an acute phase reactant protein; may have a role in the acute inflammation response. |
Alternate Names | AAG; AGP; OMD; Orm; Agpa1; ORM1; Orosomucoid 1 |