0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Rat Orosomucoid 1 (ORM1) [His-Tag], E. coli (CAT#: GP01-099J)

Datasheet
SizeQtyAdd To Basket
10 μg
50 μg
200 μg

Product Overview Recombinant Rat Orosomucoid 1 (ORM1) (NP_445740.1) (Gln19-Pro205) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity Determined by its binding ability in a functional ELISA.
Source E. coli
Species Rat
Fragment Gln19-Pro205
Sequence MGHHHHHHSGSEFQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Tag His-Tag at the N-terminus
Predicted MW 23.1 KDa
Purity >95%, determined by SDS-PAGE and HPLC
Endotoxin Level <1 EU/μg, determined by the LAL method
Conjugation Unconjugated
Target ORM1
Full Name Orosomucoid 1
Gene ID 24614
Uniprot ID P02764
Accession Number NP_445740.1
Background This protein is an acute phase reactant protein; may have a role in the acute inflammation response.
Alternate Names AAG; AGP; OMD; Orm; Agpa1; ORM1; Orosomucoid 1
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on
Close
Thanksgiving
Thanksgiving