Recombinant Rat Orosomucoid 1 (ORM1) [His-Tag], E. coli (CAT#: GP01-099J)

Product Overview	Recombinant Rat Orosomucoid 1 (ORM1) (NP_445740.1) (Gln19-Pro205) was expressed in E. coli with a His-Tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Rat
Fragment	Gln19-Pro205
Sequence	MGHHHHHHSGSEFQNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP
Tag	His-Tag at the N-terminus
Predicted MW	23.1 KDa
Purity	>95%, determined by SDS-PAGE and HPLC
Endotoxin Level	<1 EU/μg, determined by the LAL method
Conjugation	Unconjugated

Target	ORM1
Full Name	Orosomucoid 1
Gene ID	24614
Uniprot ID	P02764
Accession Number	NP_445740.1
Background	This protein is an acute phase reactant protein; may have a role in the acute inflammation response.
Alternate Names	AAG; AGP; OMD; Orm; Agpa1; ORM1; Orosomucoid 1