There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 1 mg | ||
| 500 μg | ||
| 100 μg |
| Product Overview | Recombinant Rotavirus A (isolate SI/South Africa/H96/58 ) Non-structural glycoprotein 4 (52-175 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP. |
| Biological Activity | Determined by its binding ability in a functional ELISA. |
| Source | Yeast |
| Species | Rotavirus A (isolate SI/South Africa/H96/58) |
| Fragment | 52-175 aa |
| Sequence | PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEWENGKNPYEPKEVTAAM |
| Tag | 6xHis-tag at the N-terminus |
| Predicted MW | 16.7 kDa |
| Purity | >90%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | Non-structural glycoprotein 4 |
| Full Name | Non-structural glycoprotein 4 |
| Gene ID | 7011361 |
| Uniprot ID | A2T3Q0 |
| Background | Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca2+ in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly. |
| Alternate Names | NSP4; NCVP5; NS28 |