Recombinant Rotavirus A (strain St. Thomas 3) Non-structural glycoprotein 4 (52-175 aa) [6xHis-tag], Yeast (CAT#: GPX04-400J)

Product Overview	Recombinant Rotavirus A (strain St. Thomas 3 ) Non-structural glycoprotein 4 (52-175 aa) was expressed in Yeast with a 6xHis-tag at the N-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Yeast
Species	Rotavirus A (strain St. Thomas 3)
Fragment	52-175 aa
Sequence	PTMKIALKASKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQIELLKRIHDNLITRPVNVIDMSMEFNQKNIKTLDEWESRKNPYEPSEVTASM
Tag	6xHis-tag at the N-terminus
Predicted MW	16.6 kDa
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	Non-structural glycoprotein 4
Full Name	Non-structural glycoprotein 4
Uniprot ID	Q82035
Background	Plays an essential role in the virus replication cycle by acting as a viroporin.
Alternate Names	NCVP5; NS28